SCOPe 2.05: Domain d1ceha_: 1ceh A:

Lineage for d1ceha_ (1ceh A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries)
   Uniprot P00593

8. Domain d1ceha_: 1ceh A: [19591]
   complexed with ca; mutant

Details for d1ceha_

PDB Entry: 1ceh, 1.9 Å

PDB Description: structure and function of the catalytic site mutant asp99asn of phospholipase a2: absence of conserved structural water

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1ceha_:

Sequence; same for both SEQRES and ATOM records:

>d1ceha_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
ckvlvdnpytnnysyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
knc

Timeline for d1ceha_:

• d1ceha_ first appeared (with stable ids) in SCOP 1.55, called d1ceh__
  
• d1ceha_ appears in SCOPe 2.04
  
• d1ceha_ appears in SCOPe 2.06
  
• d1ceha_ appears in the current release, SCOPe 2.08