Lineage for d1ceh__ (1ceh -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6711Protein Phospholipase A2 [48637] (3 species)
  7. 6712Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (19 PDB entries)
  8. 6721Domain d1ceh__: 1ceh - [19591]

Details for d1ceh__

PDB Entry: 1ceh (more details), 1.9 Å

PDB Description: structure and function of the catalytic site mutant asp99asn of phospholipase a2: absence of conserved structural water

SCOP Domain Sequences for d1ceh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceh__ a.133.1.2 (-) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
ckvlvdnpytnnysyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
knc

SCOP Domain Coordinates for d1ceh__:

Click to download the PDB-style file with coordinates for d1ceh__.
(The format of our PDB-style files is described here.)

Timeline for d1ceh__: