SCOPe 2.06: Domain d3vl3a1: 3vl3 A:2-364

Lineage for d3vl3a1 (3vl3 A:2-364)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (19 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:211586] [194175] (12 PDB entries)

8. Domain d3vl3a1: 3vl3 A:2-364 [195909]
   Other proteins in same PDB: d3vl3a2
   automated match to d1cnza_
   complexed with ca, cl, ipm

Details for d3vl3a1

PDB Entry: 3vl3, 1.8 Å

PDB Description: 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 340 mpa

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vl3a1:

Sequence; same for both SEQRES and ATOM records:

>d3vl3a1 c.77.1.1 (A:2-364) automated matches {Shewanella oneidensis [TaxId: 211586]}
syqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatlk
gceaadailfgsvggpkweklppneqpergallplrghfelfcnlrpaklhdglehmspl
rsdisargfdvlcvreltggiyfgkpkgrqgegeseeafdtmrysrreisriariafeaa
rgrrkkvtsvdkanvlacsvlwrqvveevavdfpdvelehiyidnatmqllrrpdefdvm
lcsnlfgdilsdeiamltgsmgllssasmnstgfglfepaggsapdiagkgianpiaqil
saalmlrhslkqeeaasaieravtkalnsgyltgellssdqrhkakttvqmgdfiadavk
agv

Timeline for d3vl3a1:

• d3vl3a1 first appeared in SCOPe 2.02, called d3vl3a_
  
• d3vl3a1 was called d3vl3a_ in SCOPe 2.05
  
• d3vl3a1 appears in SCOPe 2.07
  
• d3vl3a1 appears in the current release, SCOPe 2.08