| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries) |
| Domain d3zywb1: 3zyw B:130-232 [195904] Other proteins in same PDB: d3zywa2, d3zywb2, d3zywb3 automated match to d2yana_ complexed with edo |
PDB Entry: 3zyw (more details), 1.84 Å
SCOPe Domain Sequences for d3zywb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zywb1 c.47.1.1 (B:130-232) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kedlnlrlkklthaapcmlfmkgtpqeprcgfskqmveilhkhniqfssfdifsdeevrq
glkaysswptypqlyvsgeliggldiikeleaseeldticpka
Timeline for d3zywb1: