Lineage for d4dgqc1 (4dgq C:1-276)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151524Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2151561Protein automated matches [190860] (3 species)
    not a true protein
  7. 2151562Species Burkholderia cenocepacia [TaxId:216591] [195901] (1 PDB entry)
  8. 2151565Domain d4dgqc1: 4dgq C:1-276 [195902]
    Other proteins in same PDB: d4dgqa2, d4dgqb2, d4dgqc2
    automated match to d1zoia_
    complexed with edo

Details for d4dgqc1

PDB Entry: 4dgq (more details), 1.85 Å

PDB Description: Crystal structure of Non-heme chloroperoxidase from Burkholderia cenocepacia
PDB Compounds: (C:) Non-heme chloroperoxidase

SCOPe Domain Sequences for d4dgqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgqc1 c.69.1.12 (C:1-276) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mgtvttkdgveifykdwgprdakvihfhhgwplssddwdaqllffvnkgfrvvahdrrgh
grssqvwdghdmdhyaddaaavveklgthgamhvghstgggevvryiarhgernvskavl
issvpplmvktssnpngtpksvfddfqahvaanraqfyldvpagpfygynrpgakpsegv
iynwwrqgmmgstkaqydgivafsqtdftndlkgitipvlvihgdddqvvpyadsgvlsa
klvkngklitykgaphgiptthadkvnadlleflqs

SCOPe Domain Coordinates for d4dgqc1:

Click to download the PDB-style file with coordinates for d4dgqc1.
(The format of our PDB-style files is described here.)

Timeline for d4dgqc1: