Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
Protein automated matches [190860] (3 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [195901] (1 PDB entry) |
Domain d4dgqc1: 4dgq C:1-276 [195902] Other proteins in same PDB: d4dgqa2, d4dgqb2, d4dgqc2 automated match to d1zoia_ complexed with edo |
PDB Entry: 4dgq (more details), 1.85 Å
SCOPe Domain Sequences for d4dgqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgqc1 c.69.1.12 (C:1-276) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mgtvttkdgveifykdwgprdakvihfhhgwplssddwdaqllffvnkgfrvvahdrrgh grssqvwdghdmdhyaddaaavveklgthgamhvghstgggevvryiarhgernvskavl issvpplmvktssnpngtpksvfddfqahvaanraqfyldvpagpfygynrpgakpsegv iynwwrqgmmgstkaqydgivafsqtdftndlkgitipvlvihgdddqvvpyadsgvlsa klvkngklitykgaphgiptthadkvnadlleflqs
Timeline for d4dgqc1:
View in 3D Domains from other chains: (mouse over for more information) d4dgqa1, d4dgqa2, d4dgqb1, d4dgqb2 |