Lineage for d4ds7d_ (4ds7 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711326Species Kluyveromyces lactis [TaxId:284590] [195890] (1 PDB entry)
  8. 2711330Domain d4ds7d_: 4ds7 D: [195894]
    automated match to d1lkja_
    complexed with gol, so4, sr

Details for d4ds7d_

PDB Entry: 4ds7 (more details), 2.15 Å

PDB Description: crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
PDB Compounds: (D:) calmodulin

SCOPe Domain Sequences for d4ds7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ds7d_ a.39.1.5 (D:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
lteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnhai
efseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevde
mlrevsdgsgeinikqfaallsk

SCOPe Domain Coordinates for d4ds7d_:

Click to download the PDB-style file with coordinates for d4ds7d_.
(The format of our PDB-style files is described here.)

Timeline for d4ds7d_: