Lineage for d3s6wa_ (3s6w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784668Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species)
  7. 2784669Species Human (Homo sapiens) [TaxId:9606] [189550] (3 PDB entries)
  8. 2784670Domain d3s6wa_: 3s6w A: [195887]
    automated match to d3pmta_
    complexed with ipa

Details for d3s6wa_

PDB Entry: 3s6w (more details), 1.78 Å

PDB Description: crystal structure of tudor domain of human tdrd3
PDB Compounds: (A:) Tudor domain-containing protein 3

SCOPe Domain Sequences for d3s6wa_:

Sequence, based on SEQRES records: (download)

>d3s6wa_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi

Sequence, based on observed residues (ATOM records): (download)

>d3s6wa_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mwkpgdecfalywednkfyraevealsgmtavvkfidygnyeevllsnikpi

SCOPe Domain Coordinates for d3s6wa_:

Click to download the PDB-style file with coordinates for d3s6wa_.
(The format of our PDB-style files is described here.)

Timeline for d3s6wa_: