| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [189550] (3 PDB entries) |
| Domain d3s6wa_: 3s6w A: [195887] automated match to d3pmta_ complexed with ipa |
PDB Entry: 3s6w (more details), 1.78 Å
SCOPe Domain Sequences for d3s6wa_:
Sequence, based on SEQRES records: (download)
>d3s6wa_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi
>d3s6wa_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mwkpgdecfalywednkfyraevealsgmtavvkfidygnyeevllsnikpi
Timeline for d3s6wa_: