Lineage for d1bpq__ (1bpq -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449039Protein Phospholipase A2 [48637] (4 species)
  7. 449040Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (24 PDB entries)
  8. 449048Domain d1bpq__: 1bpq - [19588]

Details for d1bpq__

PDB Entry: 1bpq (more details), 1.8 Å

PDB Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates

SCOP Domain Sequences for d1bpq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpq__ a.133.1.2 (-) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc

SCOP Domain Coordinates for d1bpq__:

Click to download the PDB-style file with coordinates for d1bpq__.
(The format of our PDB-style files is described here.)

Timeline for d1bpq__: