Lineage for d3t4hb_ (3t4h B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138586Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1138807Family b.82.2.10: AlkB-like [141628] (3 proteins)
  6. 1138823Protein automated matches [191077] (2 species)
    not a true protein
  7. 1138842Species Escherichia coli [TaxId:83333] [195877] (1 PDB entry)
  8. 1138843Domain d3t4hb_: 3t4h B: [195878]
    automated match to d2fdja_
    complexed with epe, fe, md5

Details for d3t4hb_

PDB Entry: 3t4h (more details), 1.65 Å

PDB Description: crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(3- nitrobenzyl)-l-cysteine
PDB Compounds: (B:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3t4hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t4hb_ b.82.2.10 (B:) automated matches {Escherichia coli [TaxId: 83333]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d3t4hb_:

Click to download the PDB-style file with coordinates for d3t4hb_.
(The format of our PDB-style files is described here.)

Timeline for d3t4hb_: