Lineage for d3uega_ (3ueg A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264660Protein automated matches [190700] (1 species)
    not a true protein
  7. 2264661Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries)
  8. 2264703Domain d3uega_: 3ueg A: [195868]
    automated match to d1e31b_
    complexed with edo, pg4, zn; mutant

Details for d3uega_

PDB Entry: 3ueg (more details), 2.8 Å

PDB Description: Crystal structure of human Survivin K62A mutant
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 5

SCOPe Domain Sequences for d3uega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uega_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfael
egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
eetakkvrraieqlaam

SCOPe Domain Coordinates for d3uega_:

Click to download the PDB-style file with coordinates for d3uega_.
(The format of our PDB-style files is described here.)

Timeline for d3uega_: