Lineage for d3ug1a_ (3ug1 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (101 PDB entries)
    Uniprot P00533 702-1018
  8. 2543569Domain d3ug1a_: 3ug1 A: [195858]
    automated match to d2gs6a_
    complexed with mes

Details for d3ug1a_

PDB Entry: 3ug1 (more details), 2.75 Å

PDB Description: Crystal structure of the mutated EGFR kinase domain (G719S/T790M) in the apo form
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3ug1a_:

Sequence, based on SEQRES records: (download)

>d3ug1a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsn
fyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d3ug1a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlssgtvykglwipegekvkipvaikespkankeildeay
vmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakg
mnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmale
silhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvy
mimvkcwmidadsrpkfreliiefskmardpqrylviqgddeedmddvvdadeyli

SCOPe Domain Coordinates for d3ug1a_:

Click to download the PDB-style file with coordinates for d3ug1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ug1a_: