Lineage for d2y6ka_ (2y6k A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370086Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 2370100Protein automated matches [191099] (1 species)
    not a true protein
  7. 2370101Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries)
  8. 2370106Domain d2y6ka_: 2y6k A: [195852]
    automated match to d3jxsa_
    complexed with ca, cit

Details for d2y6ka_

PDB Entry: 2y6k (more details), 1.36 Å

PDB Description: xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y6ka_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
lvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavtv
ngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsldeygrlhhqqi
ttewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd

SCOPe Domain Coordinates for d2y6ka_:

Click to download the PDB-style file with coordinates for d2y6ka_.
(The format of our PDB-style files is described here.)

Timeline for d2y6ka_: