![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.14: CBM4/9 [74893] (4 proteins) |
![]() | Protein automated matches [191099] (1 species) not a true protein |
![]() | Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries) |
![]() | Domain d2y6ka_: 2y6k A: [195852] automated match to d3jxsa_ complexed with ca, cit |
PDB Entry: 2y6k (more details), 1.36 Å
SCOPe Domain Sequences for d2y6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y6ka_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]} lvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavtv ngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsldeygrlhhqqi ttewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd
Timeline for d2y6ka_: