SCOPe 2.02: Domain d2y6ga_: 2y6g A:

Lineage for d2y6ga_ (2y6g A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein automated matches [191099] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [189091] (7 PDB entries)

8. Domain d2y6ga_: 2y6g A: [195849]
   automated match to d3jxsa_
   complexed with ca

Details for d2y6ga_

PDB Entry: 2y6g, 1.3 Å

PDB Description: cellopentaose binding mutated (x-2 l110f) cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y6ga_:

Sequence; same for both SEQRES and ATOM records:

>d2y6ga_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivdl

Timeline for d2y6ga_:

• d2y6ga_ is new in SCOPe 2.02-stable
  
• d2y6ga_ appears in SCOPe 2.03
  
• d2y6ga_ appears in the current release, SCOPe 2.08, called d2y6ga1