| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.14: CBM4/9 [74893] (4 proteins) |
| Protein automated matches [191099] (1 species) not a true protein |
| Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries) |
| Domain d2y6ga1: 2y6g A:2-166 [195849] Other proteins in same PDB: d2y6ga2, d2y6ga3 automated match to d3jxsa_ complexed with ca |
PDB Entry: 2y6g (more details), 1.3 Å
SCOPe Domain Sequences for d2y6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y6ga1 b.18.1.14 (A:2-166) automated matches {Rhodothermus marinus [TaxId: 29549]}
lvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavtv
ngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqqi
ttewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd
Timeline for d2y6ga1: