Lineage for d2y6ha1 (2y6h A:2-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774616Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 2774630Protein automated matches [191099] (1 species)
    not a true protein
  7. 2774631Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries)
  8. 2774633Domain d2y6ha1: 2y6h A:2-166 [195847]
    Other proteins in same PDB: d2y6ha2, d2y6ha3
    automated match to d3jxsa_
    complexed with ca

Details for d2y6ha1

PDB Entry: 2y6h (more details), 1.08 Å

PDB Description: x-2 l110f cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y6ha1 b.18.1.14 (A:2-166) automated matches {Rhodothermus marinus [TaxId: 29549]}
lvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavtv
ngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqqi
ttewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd

SCOPe Domain Coordinates for d2y6ha1:

Click to download the PDB-style file with coordinates for d2y6ha1.
(The format of our PDB-style files is described here.)

Timeline for d2y6ha1: