![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
![]() | Protein automated matches [190491] (18 species) not a true protein |
![]() | Species Clostridium difficile [TaxId:272563] [195841] (1 PDB entry) |
![]() | Domain d4duna1: 4dun A:1-258 [195842] Other proteins in same PDB: d4duna2 automated match to d1s7ja_ complexed with btb, ni, so4 |
PDB Entry: 4dun (more details), 1.76 Å
SCOPe Domain Sequences for d4duna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duna1 d.21.1.0 (A:1-258) automated matches {Clostridium difficile [TaxId: 272563]} meyyivdsfatklfkgnpagvcvldrriplelmqkiaeennlpetafvvkgkgnyelrwf tpkaeidlcghatlaaayvisnfidvnvkkidfftqsgklevtrngnlyemifpeimpie ielspqqanligcvpsdvyssrdlilllnseqevinykpnyaqlrkltdwlgiiitaqgs ntdfvsryfcpeldsedpvtgsshcnlipywseklgkhkmvaaqlsnrggiiqcevlkdn tvkisgeavlfmqgtiki
Timeline for d4duna1: