SCOPe 2.08: Domain d4duna1: 4dun A:1-258

Lineage for d4duna1 (4dun A:1-258)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [195841] (1 PDB entry)

8. Domain d4duna1: 4dun A:1-258 [195842]
   Other proteins in same PDB: d4duna2
   automated match to d1s7ja_
   complexed with btb, ni, so4

Details for d4duna1

PDB Entry: 4dun, 1.76 Å

PDB Description: 1.76A X-ray Crystal Structure of a Putative Phenazine Biosynthesis PhzC/PhzF Protein from Clostridium difficile (strain 630)

PDB Compounds: (A:) Putative phenazine biosynthesis PhzC/PhzF protein

SCOPe Domain Sequences for d4duna1:

Sequence; same for both SEQRES and ATOM records:

>d4duna1 d.21.1.0 (A:1-258) automated matches {Clostridium difficile [TaxId: 272563]}
meyyivdsfatklfkgnpagvcvldrriplelmqkiaeennlpetafvvkgkgnyelrwf
tpkaeidlcghatlaaayvisnfidvnvkkidfftqsgklevtrngnlyemifpeimpie
ielspqqanligcvpsdvyssrdlilllnseqevinykpnyaqlrkltdwlgiiitaqgs
ntdfvsryfcpeldsedpvtgsshcnlipywseklgkhkmvaaqlsnrggiiqcevlkdn
tvkisgeavlfmqgtiki

Timeline for d4duna1:

• d4duna1 first appeared in SCOPe 2.02, called d4duna_
  
• d4duna1 appears in SCOPe 2.07