Lineage for d4dyuk_ (4dyu K:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084902Protein automated matches [190041] (21 species)
    not a true protein
  7. 1085168Species Yersinia pestis [TaxId:187410] [195837] (1 PDB entry)
  8. 1085169Domain d4dyuk_: 4dyu K: [195838]
    automated match to d3ak8i_
    complexed with so4, zn

Details for d4dyuk_

PDB Entry: 4dyu (more details), 2.75 Å

PDB Description: The crystal structure of DNA starvation/stationary phase protection protein Dps from Yersinia pestis KIM 10
PDB Compounds: (K:) DNA protection during starvation protein

SCOPe Domain Sequences for d4dyuk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dyuk_ a.25.1.1 (K:) automated matches {Yersinia pestis [TaxId: 187410]}
ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
rkaitevedensadmftaasrdldkflwfiesnie

SCOPe Domain Coordinates for d4dyuk_:

Click to download the PDB-style file with coordinates for d4dyuk_.
(The format of our PDB-style files is described here.)

Timeline for d4dyuk_: