Lineage for d3qb4a_ (3qb4 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260706Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2260707Protein automated matches [190506] (3 species)
    not a true protein
  7. 2260708Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)
  8. 2260730Domain d3qb4a_: 3qb4 A: [195836]
    Other proteins in same PDB: d3qb4b_, d3qb4d_
    automated match to d2bhka_

Details for d3qb4a_

PDB Entry: 3qb4 (more details), 2.28 Å

PDB Description: crystal structure of a tgf-beta ligand-receptor complex
PDB Compounds: (A:) Growth/differentiation factor 5

SCOPe Domain Sequences for d3qb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qb4a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplashleptnhaviqtlmnsm
dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

SCOPe Domain Coordinates for d3qb4a_:

Click to download the PDB-style file with coordinates for d3qb4a_.
(The format of our PDB-style files is described here.)

Timeline for d3qb4a_: