SCOPe 2.02: Domain d3qb4a_: 3qb4 A:

Lineage for d3qb4a_ (3qb4 A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (14 PDB entries)

8. Domain d3qb4a_: 3qb4 A: [195836]
   automated match to d2bhka_

Details for d3qb4a_

PDB Entry: 3qb4, 2.28 Å

PDB Description: crystal structure of a tgf-beta ligand-receptor complex

PDB Compounds: (A:) Growth/differentiation factor 5

SCOPe Domain Sequences for d3qb4a_:

Sequence; same for both SEQRES and ATOM records:

>d3qb4a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplashleptnhaviqtlmnsm
dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

Timeline for d3qb4a_:

• d3qb4a_ is new in SCOPe 2.02-stable
  
• d3qb4a_ appears in SCOPe 2.03
  
• d3qb4a_ appears in the current release, SCOPe 2.08