SCOPe 2.06: Domain d3qb4c_: 3qb4 C:

Lineage for d3qb4c_ (3qb4 C:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)

8. Domain d3qb4c_: 3qb4 C: [195835]
   Other proteins in same PDB: d3qb4b_, d3qb4d_
   automated match to d2bhka_

Details for d3qb4c_

PDB Entry: 3qb4, 2.28 Å

PDB Description: crystal structure of a tgf-beta ligand-receptor complex

PDB Compounds: (C:) Growth/differentiation factor 5

SCOPe Domain Sequences for d3qb4c_:

Sequence; same for both SEQRES and ATOM records:

>d3qb4c_ g.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplashleptnhaviqtlmns
mdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

Timeline for d3qb4c_:

• d3qb4c_ first appeared in SCOPe 2.02
  
• d3qb4c_ appears in SCOPe 2.05
  
• d3qb4c_ appears in SCOPe 2.07
  
• d3qb4c_ appears in the current release, SCOPe 2.08