Lineage for d3qb4c_ (3qb4 C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033970Domain d3qb4c_: 3qb4 C: [195835]
    Other proteins in same PDB: d3qb4b_, d3qb4d_
    automated match to d2bhka_

Details for d3qb4c_

PDB Entry: 3qb4 (more details), 2.28 Å

PDB Description: crystal structure of a tgf-beta ligand-receptor complex
PDB Compounds: (C:) Growth/differentiation factor 5

SCOPe Domain Sequences for d3qb4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qb4c_ g.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplashleptnhaviqtlmns
mdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

SCOPe Domain Coordinates for d3qb4c_:

Click to download the PDB-style file with coordinates for d3qb4c_.
(The format of our PDB-style files is described here.)

Timeline for d3qb4c_: