Lineage for d3r8ab1 (3r8a B:207-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728976Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2728977Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
    Uniprot P37231 232-505
  8. 2729091Domain d3r8ab1: 3r8a B:207-475 [195833]
    Other proteins in same PDB: d3r8ab2
    automated match to d1rdtd_
    complexed with hig

Details for d3r8ab1

PDB Entry: 3r8a (more details), 2.41 Å

PDB Description: X-ray crystal structure of the nuclear hormone receptor PPAR-gamma in a complex with a compound with dual PPAR gamma agonism and Angiotensin II Type I receptor antagonism activity
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3r8ab1:

Sequence, based on SEQRES records: (download)

>d3r8ab1 a.123.1.1 (B:207-475) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d3r8ab1 a.123.1.1 (B:207-475) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmevairifqgcqf
rsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgf
mtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpie
diqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvhpllqeiykd

SCOPe Domain Coordinates for d3r8ab1:

Click to download the PDB-style file with coordinates for d3r8ab1.
(The format of our PDB-style files is described here.)

Timeline for d3r8ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r8ab2
View in 3D
Domains from other chains:
(mouse over for more information)
d3r8aa_