Lineage for d3swdl_ (3swd L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957100Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2957232Protein automated matches [190917] (11 species)
    not a true protein
  7. 2957241Species Escherichia coli K-12 [TaxId:83333] [188769] (8 PDB entries)
  8. 2957271Domain d3swdl_: 3swd L: [195828]
    automated match to d1a2na_
    complexed with epz

Details for d3swdl_

PDB Entry: 3swd (more details), 2.5 Å

PDB Description: E. coli MurA in complex with UDP-N-acetylmuramic acid and covalent adduct of PEP with Cys115
PDB Compounds: (L:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3swdl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swdl_ d.68.2.2 (L:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
gakverdgsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggxtigar
pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg

SCOPe Domain Coordinates for d3swdl_:

Click to download the PDB-style file with coordinates for d3swdl_.
(The format of our PDB-style files is described here.)

Timeline for d3swdl_: