Lineage for d3tzfa_ (3tzf A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1150407Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1150408Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 1150432Protein automated matches [194480] (2 species)
    not a true protein
  7. 1150436Species Yersinia pestis [TaxId:632] [195817] (1 PDB entry)
  8. 1150437Domain d3tzfa_: 3tzf A: [195819]
    automated match to d1aj2a_
    complexed with 08d, hh2, mg

Details for d3tzfa_

PDB Entry: 3tzf (more details), 2.1 Å

PDB Description: Crystal Structure of the Yersinia pestis Dihydropteroate Synthase with Sulfonamide Drug Complex.
PDB Compounds: (A:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tzfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzfa_ c.1.21.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsa

SCOPe Domain Coordinates for d3tzfa_:

Click to download the PDB-style file with coordinates for d3tzfa_.
(The format of our PDB-style files is described here.)

Timeline for d3tzfa_: