![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein automated matches [190204] (3 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [195809] (1 PDB entry) |
![]() | Domain d4db5a_: 4db5 A: [195810] automated match to d3b93a1 complexed with b3p |
PDB Entry: 4db5 (more details), 1.52 Å
SCOPe Domain Sequences for d4db5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4db5a_ b.22.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} acvakfgplpskwqmeppkpscvnkisdwklkilqnglyiiygqvapdptykgfapfevq lcknkeaiqtltnnskiqnlggiyefdagdiielrfnsddqvlknntywgivllvtpqfs s
Timeline for d4db5a_: