SCOPe 2.08: Domain d4dsda_: 4dsd A:

Lineage for d4dsda_ (4dsd A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.2: BT0923-like [160574] (2 families)
   Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices

5. Family d.98.2.0: automated matches [195801] (1 protein)
   not a true family

6. Protein automated matches [195802] (3 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:411476] [195803] (1 PDB entry)

8. Domain d4dsda_: 4dsd A: [195808]
   automated match to d3elgb_
   complexed with edo

Details for d4dsda_

PDB Entry: 4dsd, 1.75 Å

PDB Description: crystal structure of a putative periplasmic protein (bacova_05534) from bacteroides ovatus atcc 8483 at 1.75 a resolution

PDB Compounds: (A:) Putative periplasmic protein

SCOPe Domain Sequences for d4dsda_:

Sequence; same for both SEQRES and ATOM records:

>d4dsda_ d.98.2.0 (A:) automated matches {Bacteroides ovatus [TaxId: 411476]}
kdvitkdmnqlplparnfinsnftkpqvahikidkdmmestkyevvlmdgteidfdskgn
weevsakkgqtvpvsivpgfavnylkahnfvnegvtkverdrkgyeielstglsfkfdkk
gkfikt

Timeline for d4dsda_:

• d4dsda_ first appeared in SCOPe 2.02
  
• d4dsda_ appears in SCOPe 2.07