SCOPe 2.08: Domain d4e08b_: 4e08 B:

Lineage for d4e08b_ (4e08 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195790] (1 PDB entry)

8. Domain d4e08b_: 4e08 B: [195792]
   automated match to d3b38a_
   complexed with so4

Details for d4e08b_

PDB Entry: 4e08, 2 Å

PDB Description: Crystal structure of Drosophila melanogaster DJ-1beta

PDB Compounds: (B:) DJ-1 beta

SCOPe Domain Sequences for d4e08b_:

Sequence; same for both SEQRES and ATOM records:

>d4e08b_ c.23.16.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msksalvilapgaeemefiiaadvlrragikvtvaglnggeavkcsrdvqilpdtslaqv
asdkfdvvvlpgglggsnamgesslvgdllrsqesgggliaaicaaptvlakhgvasgks
ltsypsmkpqlvnnysyvddktvvkdgnlitsrgpgtayefalkiaeelagkekvqevak
gllvay

Timeline for d4e08b_:

• d4e08b_ first appeared in SCOPe 2.02
  
• d4e08b_ appears in SCOPe 2.07