Lineage for d4e08b_ (4e08 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859419Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195790] (1 PDB entry)
  8. 2859421Domain d4e08b_: 4e08 B: [195792]
    automated match to d3b38a_
    complexed with so4

Details for d4e08b_

PDB Entry: 4e08 (more details), 2 Å

PDB Description: Crystal structure of Drosophila melanogaster DJ-1beta
PDB Compounds: (B:) DJ-1 beta

SCOPe Domain Sequences for d4e08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e08b_ c.23.16.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msksalvilapgaeemefiiaadvlrragikvtvaglnggeavkcsrdvqilpdtslaqv
asdkfdvvvlpgglggsnamgesslvgdllrsqesgggliaaicaaptvlakhgvasgks
ltsypsmkpqlvnnysyvddktvvkdgnlitsrgpgtayefalkiaeelagkekvqevak
gllvay

SCOPe Domain Coordinates for d4e08b_:

Click to download the PDB-style file with coordinates for d4e08b_.
(The format of our PDB-style files is described here.)

Timeline for d4e08b_: