Lineage for d3s54b_ (3s54 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1130029Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1130045Protein Human immunodeficiency virus type 1 protease [50632] (7 species)
  7. 1130131Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1130265Domain d3s54b_: 3s54 B: [195774]
    automated match to d2hs1a_
    complexed with 017, act, cl, gol, na; mutant

Details for d3s54b_

PDB Entry: 3s54 (more details), 1.42 Å

PDB Description: HIV-1 protease triple mutants V32I, I47V, V82I with antiviral drug darunavir in space group P21212
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3s54b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s54b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtiieemslpgrwkpkmvggiggfikvrqyd
qiiieiaghkaigtvlvgptpiniigrnlltqigatlnf

SCOPe Domain Coordinates for d3s54b_:

Click to download the PDB-style file with coordinates for d3s54b_.
(The format of our PDB-style files is described here.)

Timeline for d3s54b_: