SCOPe 2.05: Domain d3s54a_: 3s54 A:

Lineage for d3s54a_ (3s54 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3s54a_: 3s54 A: [195773]
   automated match to d2hs1a_
   complexed with 017, act, cl, gol, na; mutant

Details for d3s54a_

PDB Entry: 3s54, 1.42 Å

PDB Description: HIV-1 protease triple mutants V32I, I47V, V82I with antiviral drug darunavir in space group P21212

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3s54a_:

Sequence; same for both SEQRES and ATOM records:

>d3s54a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtiieemslpgrwkpkmvggiggfikvrqyd
qiiieiaghkaigtvlvgptpiniigrnlltqigatlnf

Timeline for d3s54a_:

• d3s54a_ first appeared in SCOPe 2.02
  
• d3s54a_ appears in SCOPe 2.04
  
• d3s54a_ appears in SCOPe 2.06
  
• d3s54a_ appears in the current release, SCOPe 2.08