SCOPe 2.07: Domain d3s45b_: 3s45 B:

Lineage for d3s45b_ (3s45 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 2 [TaxId:11709] [195770] (1 PDB entry)

8. Domain d3s45b_: 3s45 B: [195772]
   automated match to d1hsha_
   complexed with 478, cl, imd, na, zn

Details for d3s45b_

PDB Entry: 3s45, 1.51 Å

PDB Description: wild-type HIV-2 protease with antiviral drug amprenavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3s45b_:

Sequence; same for both SEQRES and ATOM records:

>d3s45b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d3s45b_:

• d3s45b_ first appeared in SCOPe 2.02
  
• d3s45b_ appears in SCOPe 2.06
  
• d3s45b_ appears in the current release, SCOPe 2.08