Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus 2 [TaxId:11709] [195770] (1 PDB entry) |
Domain d3s45a_: 3s45 A: [195771] automated match to d1hsha_ complexed with 478, cl, imd, na, zn |
PDB Entry: 3s45 (more details), 1.51 Å
SCOPe Domain Sequences for d3s45a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s45a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 2 [TaxId: 11709]} pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk nveievlnkkvratimtgdtpinifgrniltalgmslnl
Timeline for d3s45a_: