SCOPe 2.08: Domain d3tifa_: 3tif A:

Lineage for d3tifa_ (3tif A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [195767] (1 PDB entry)

8. Domain d3tifa_: 3tif A: [195769]
   automated match to d1l2tb_
   complexed with adp, ipa, na, pi

Details for d3tifa_

PDB Entry: 3tif, 1.8 Å

PDB Description: dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi

PDB Compounds: (A:) Uncharacterized ABC transporter ATP-binding protein MJ0796

SCOPe Domain Sequences for d3tifa_:

Sequence; same for both SEQRES and ATOM records:

>d3tifa_ c.37.1.12 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mvklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg
evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee
rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladqptwaldskt
gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklr

Timeline for d3tifa_:

• d3tifa_ first appeared in SCOPe 2.02
  
• d3tifa_ appears in SCOPe 2.07