Lineage for d3u43a_ (3u43 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-down
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) 
automatically mapped to Pfam PF01320Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) 
Protein automated matches [190365] (1 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [187200] (5 PDB entries) 
Domain d3u43a_: 3u43 A: [195766]
Other proteins in same PDB: d3u43b_
automated match to d2wpta_
complexed with ca, zn
Details for d3u43a_
PDB Entry: 3u43 (more details), 1.72 Å
PDB Description: Crystal structure of the colicin E2 DNase-Im2 complex
PDB Compounds: (A:) colicin-e2 immunity proteinSCOPe Domain Sequences for d3u43a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u43a_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflefvkkicraegateeddnklvreferltehpdgsdliyyprddred
spegivkeikewraangksgfkqglehhhhhh
SCOPe Domain Coordinates for d3u43a_:
Click to download the PDB-style file with coordinates for d3u43a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3u43a_:
- d3u43a_ first appeared in SCOPe 2.02
- d3u43a_ appears in SCOPe 2.04
- d3u43a_ is called d3u43a1 in SCOPe 2.06
- d3u43a_ appears in the current release, SCOPe 2.08, called d3u43a1
View in 3D
