Lineage for d3u43a_ (3u43 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487541Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
    automatically mapped to Pfam PF01320
  5. 1487542Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1487590Protein automated matches [190365] (1 species)
    not a true protein
  7. 1487591Species Escherichia coli [TaxId:562] [187200] (5 PDB entries)
  8. 1487592Domain d3u43a_: 3u43 A: [195766]
    Other proteins in same PDB: d3u43b_
    automated match to d2wpta_
    complexed with ca, zn

Details for d3u43a_

PDB Entry: 3u43 (more details), 1.72 Å

PDB Description: Crystal structure of the colicin E2 DNase-Im2 complex
PDB Compounds: (A:) colicin-e2 immunity protein

SCOPe Domain Sequences for d3u43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u43a_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflefvkkicraegateeddnklvreferltehpdgsdliyyprddred
spegivkeikewraangksgfkqglehhhhhh

SCOPe Domain Coordinates for d3u43a_:

Click to download the PDB-style file with coordinates for d3u43a_.
(The format of our PDB-style files is described here.)

Timeline for d3u43a_: