Lineage for d3u43a1 (3u43 A:3-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706394Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2706395Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 2706445Protein automated matches [190365] (1 species)
    not a true protein
  7. 2706446Species Escherichia coli [TaxId:562] [187200] (5 PDB entries)
  8. 2706447Domain d3u43a1: 3u43 A:3-86 [195766]
    Other proteins in same PDB: d3u43a2, d3u43b_
    automated match to d2wpta_
    complexed with ca, zn

Details for d3u43a1

PDB Entry: 3u43 (more details), 1.72 Å

PDB Description: Crystal structure of the colicin E2 DNase-Im2 complex
PDB Compounds: (A:) colicin-e2 immunity protein

SCOPe Domain Sequences for d3u43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u43a1 a.28.2.1 (A:3-86) automated matches {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflefvkkicraegateeddnklvreferltehpdgsdliyyprddred
spegivkeikewraangksgfkqg

SCOPe Domain Coordinates for d3u43a1:

Click to download the PDB-style file with coordinates for d3u43a1.
(The format of our PDB-style files is described here.)

Timeline for d3u43a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u43a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3u43b_