SCOPe 2.06: Domain d3v1kb_: 3v1k B:

Lineage for d3v1kb_ (3v1k B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
   closely related to the Proline iminopeptidase-like family

6. Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)

7. Species Burkholderia xenovorans [TaxId:36873] [159736] (13 PDB entries)
   Uniprot P47229 4-286

8. Domain d3v1kb_: 3v1k B: [195764]
   automated match to d2og1a_
   complexed with mla; mutant

Details for d3v1kb_

PDB Entry: 3v1k, 2.13 Å

PDB Description: crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400.

PDB Compounds: (B:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d3v1kb_:

Sequence; same for both SEQRES and ATOM records:

>d3v1kb_ c.69.1.10 (B:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnsmggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcgqwaqwehadefnrlvidflrha

Timeline for d3v1kb_:

• d3v1kb_ first appeared in SCOPe 2.02
  
• d3v1kb_ appears in SCOPe 2.05
  
• d3v1kb_ appears in SCOPe 2.07
  
• d3v1kb_ appears in the current release, SCOPe 2.08