SCOPe 2.07: Domain d3voja1: 3voj A:75-433

Lineage for d3voja1 (3voj A:75-433)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.0: automated matches [195757] (1 protein)
   not a true family

6. Protein automated matches [195758] (2 species)
   not a true protein

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (9 PDB entries)

8. Domain d3voja1: 3voj A:75-433 [195761]
   Other proteins in same PDB: d3voja2
   automated match to d1oc7a_
   mutant

Details for d3voja1

PDB Entry: 3voj, 2.29 Å

PDB Description: CcCel6A catalytic domain mutant D164A

PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3voja1:

Sequence; same for both SEQRES and ATOM records:

>d3voja1 c.6.1.0 (A:75-433) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
pstgnpfegydiylspyyaeeveaaaamiddpvlkakalkvkeiptfiwfdvvrktpdlg
ryladataiqqrtgrkqlvqivvydlpdracaaaasngefsladggmekykdyvdrlase
irkypdvrivaviepdslanmvtnmnvakcrgaeaaykegviyalrqlsalgvysyvdag
hagwlgwnanlapsarlfaqiykdagrsafirglatnvsnynalsattrdpvtqgndnyd
elrfinalapllrnegwdakfivdqgrsgvqnirqewgnwcnvygagfgmrptlntpssa
idaivwikpggeadgtsdtsaprydthcgksdshkpapeagtwfqeyfvnlvknanppl

Timeline for d3voja1:

• d3voja1 first appeared in SCOPe 2.02, called d3voja_
  
• d3voja1 appears in SCOPe 2.06
  
• d3voja1 appears in the current release, SCOPe 2.08