SCOPe 2.02: Domain d3voha_: 3voh A:

Lineage for d3voha_ (3voh A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.0: automated matches [195757] (1 protein)
   not a true family

6. Protein automated matches [195758] (1 species)
   not a true protein

7. Species Coprinopsis cinerea [TaxId:5346] [195759] (2 PDB entries)

8. Domain d3voha_: 3voh A: [195760]
   automated match to d1oc7a_
   complexed with bgc, cbi, ct3

Details for d3voha_

PDB Entry: 3voh, 2.4 Å

PDB Description: cccel6a catalytic domain complexed with cellobiose

PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3voha_:

Sequence; same for both SEQRES and ATOM records:

>d3voha_ c.6.1.0 (A:) automated matches {Coprinopsis cinerea [TaxId: 5346]}
vpstgnpfegydiylspyyaeeveaaaamiddpvlkakalkvkeiptfiwfdvvrktpdl
gryladataiqqrtgrkqlvqivvydlpdrdcaaaasngefsladggmekykdyvdrlas
eirkypdvrivaviepdslanmvtnmnvakcrgaeaaykegviyalrqlsalgvysyvda
ghagwlgwnanlapsarlfaqiykdagrsafirglatnvsnynalsattrdpvtqgndny
delrfinalapllrnegwdakfivdqgrsgvqnirqewgnwcnvygagfgmrptlntpss
aidaivwikpggeadgtsdtsaprydthcgksdshkpapeagtwfqeyfvnlvknanppl
aa

Timeline for d3voha_:

• d3voha_ is new in SCOPe 2.02-stable
  
• d3voha_ appears in SCOPe 2.03
  
• d3voha_ appears in the current release, SCOPe 2.08, called d3voha1