Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Phospholipase A2 [48637] (5 species) |
Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (16 PDB entries) |
Domain d1aypb_: 1ayp B: [19576] complexed with ca, inb |
PDB Entry: 1ayp (more details), 2.57 Å
SCOPe Domain Sequences for d1aypb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aypb_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} nlvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs tprc
Timeline for d1aypb_: