SCOPe 2.06: Domain d4a16b1: 4a16 B:4-543

Lineage for d4a16b1 (4a16 B:4-543)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
   automatically mapped to Pfam PF00135

6. Protein automated matches [190065] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187006] (55 PDB entries)

8. Domain d4a16b1: 4a16 B:4-543 [195751]
   Other proteins in same PDB: d4a16a2, d4a16b2, d4a16c2, d4a16d2
   automated match to d2wu3a_
   complexed with cl, h34, nag, so4

Details for d4a16b1

PDB Entry: 4a16, 2.65 Å

PDB Description: structure of mouse acetylcholinesterase complex with huprine derivative

PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d4a16b1:

Sequence; same for both SEQRES and ATOM records:

>d4a16b1 c.69.1.1 (B:4-543) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

Timeline for d4a16b1:

• d4a16b1 first appeared in SCOPe 2.02, called d4a16b_
  
• d4a16b1 was called d4a16b_ in SCOPe 2.05
  
• d4a16b1 appears in SCOPe 2.07
  
• d4a16b1 appears in the current release, SCOPe 2.08