Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (43 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
Domain d4dwoa_: 4dwo A: [195746] automated match to d3niwa_ complexed with gol, mg |
PDB Entry: 4dwo (more details), 1.5 Å
SCOPe Domain Sequences for d4dwoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dwoa_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} kyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelrmne fggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivtensl dpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkinvfr sepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgnaqe pvkkaadyitltndedgvaeaierifnv
Timeline for d4dwoa_: