Lineage for d4dwoa_ (4dwo A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394469Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 1394479Domain d4dwoa_: 4dwo A: [195746]
    automated match to d3niwa_
    complexed with gol, mg

Details for d4dwoa_

PDB Entry: 4dwo (more details), 1.5 Å

PDB Description: crystal structure of a haloacid dehalogenase-like hydrolase (target efi-900331) from bacteroides thetaiotaomicron with bound mg crystal form ii
PDB Compounds: (A:) Haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d4dwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwoa_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
kyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelrmne
fggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivtensl
dpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkinvfr
sepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgnaqe
pvkkaadyitltndedgvaeaierifnv

SCOPe Domain Coordinates for d4dwoa_:

Click to download the PDB-style file with coordinates for d4dwoa_.
(The format of our PDB-style files is described here.)

Timeline for d4dwoa_: