Lineage for d4dz3b_ (4dz3 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.0: automated matches [191631] (1 protein)
not a true familyProtein automated matches [191162] (23 species)
not a true protein
Species Burkholderia pseudomallei [TaxId:320372] [195739] (2 PDB entries) 
Domain d4dz3b_: 4dz3 B: [195741]
automated match to d1fkla_
complexed with act, ca, edo, fk5; mutant
Details for d4dz3b_
PDB Entry: 4dz3 (more details), 2 Å
PDB Description: Crystal structure of a Peptidyl-prolyl cis-trans isomerase with surface mutation M61H from Burkholderia pseudomallei complexed with FK506
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomeraseSCOPe Domain Sequences for d4dz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dz3b_ d.26.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
stvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
hvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv
SCOPe Domain Coordinates for d4dz3b_:
Click to download the PDB-style file with coordinates for d4dz3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dz3b_:
- d4dz3b_ first appeared in SCOPe 2.02
- d4dz3b_ appears in SCOPe 2.04
- d4dz3b_ is called d4dz3b1 in SCOPe 2.06
- d4dz3b_ appears in the current release, SCOPe 2.08, called d4dz3b1
View in 3D
