![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [195739] (2 PDB entries) |
![]() | Domain d4dz2b1: 4dz2 B:2-113 [195740] Other proteins in same PDB: d4dz2a2, d4dz2b2 automated match to d1fkla_ complexed with ca, fk5; mutant |
PDB Entry: 4dz2 (more details), 2 Å
SCOPe Domain Sequences for d4dz2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dz2b1 d.26.1.0 (B:2-113) automated matches {Burkholderia pseudomallei [TaxId: 320372]} tvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlgggm vikgwdegvqgmkvggvrrltippqlgygaggaggvippnatlvfevelldv
Timeline for d4dz2b1: