Lineage for d4e4ya_ (4e4y A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831200Species Francisella tularensis [TaxId:177416] [195722] (2 PDB entries)
  8. 1831201Domain d4e4ya_: 4e4y A: [195723]
    automated match to d2d1yb_
    complexed with gol, so4

Details for d4e4ya_

PDB Entry: 4e4y (more details), 1.8 Å

PDB Description: The crystal structure of a short chain dehydrogenase family protein from Francisella tularensis subsp. tularensis SCHU S4
PDB Compounds: (A:) Short chain dehydrogenase family protein

SCOPe Domain Sequences for d4e4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ya_ c.2.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
amanylvtggskgigkavvelllqnknhtvinidiqqsfsaenlkfikadltkqqditnv
ldiiknvsfdgiflnagilikgsifdidiesikkvldlnvwssiyfikglennlkvgasi
vfngsdqcfiakpnsfaytlskgaiaqmtkslaldlakyqirvntvcpgtvdtdlyrnli
qkyannvgisfdeaqkqeekefplnriaqpqeiaelvifllsdkskfmtgglipidggyt
aq

SCOPe Domain Coordinates for d4e4ya_:

Click to download the PDB-style file with coordinates for d4e4ya_.
(The format of our PDB-style files is described here.)

Timeline for d4e4ya_: