Lineage for d4e6ya_ (4e6y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336030Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2336031Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2336032Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2336098Protein automated matches [190675] (10 species)
    not a true protein
  7. 2336146Species Vibrio vulnificus [TaxId:216895] [195719] (1 PDB entry)
  8. 2336147Domain d4e6ya_: 4e6y A: [195720]
    automated match to d1k3pa_
    complexed with fmt

Details for d4e6ya_

PDB Entry: 4e6y (more details), 2.5 Å

PDB Description: type ii citrate synthase from vibrio vulnificus.
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d4e6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6ya_ a.103.1.1 (A:) automated matches {Vibrio vulnificus [TaxId: 216895]}
dkkatlhvegkapielpimegslgtpvidvrklgangyftfdpgflatascesqityidg
gkgillhrgypidqlannadylevcyillygeaptreqyekfkttvtrhtmvheqiasff
hgfrrdahpmavmcgvvgalaafyhdsldinndlhreitayrllskmptlaamcykystg
qpfiyprndlsyaenflhmmfatpceeyevnpvvaramdkiftlhadheqnaststvrla
gssganpfaciaagiaslwgpahgganeaclkmleeigsvdnipeyvdrakdkddpfrlm
gfghrvyknydpratvmretchevlkelniqdplldvamelerialsdeyfvskklypnv
dfysgiilkaigipvsmftvifaisrtigwiahwnemhsdplnrigrprqlytgevqrdf
qpmher

SCOPe Domain Coordinates for d4e6ya_:

Click to download the PDB-style file with coordinates for d4e6ya_.
(The format of our PDB-style files is described here.)

Timeline for d4e6ya_: