![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein automated matches [190675] (10 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [195719] (1 PDB entry) |
![]() | Domain d4e6ya_: 4e6y A: [195720] automated match to d1k3pa_ complexed with fmt |
PDB Entry: 4e6y (more details), 2.5 Å
SCOPe Domain Sequences for d4e6ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e6ya_ a.103.1.1 (A:) automated matches {Vibrio vulnificus [TaxId: 216895]} dkkatlhvegkapielpimegslgtpvidvrklgangyftfdpgflatascesqityidg gkgillhrgypidqlannadylevcyillygeaptreqyekfkttvtrhtmvheqiasff hgfrrdahpmavmcgvvgalaafyhdsldinndlhreitayrllskmptlaamcykystg qpfiyprndlsyaenflhmmfatpceeyevnpvvaramdkiftlhadheqnaststvrla gssganpfaciaagiaslwgpahgganeaclkmleeigsvdnipeyvdrakdkddpfrlm gfghrvyknydpratvmretchevlkelniqdplldvamelerialsdeyfvskklypnv dfysgiilkaigipvsmftvifaisrtigwiahwnemhsdplnrigrprqlytgevqrdf qpmher
Timeline for d4e6ya_: