Lineage for d3r34a_ (3r34 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201307Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1201400Protein automated matches [190102] (5 species)
    not a true protein
  7. Species Arthrobacter sp. [TaxId:1667] [194804] (9 PDB entries)
  8. 1201404Domain d3r34a_: 3r34 A: [195717]
    automated match to d1q4ta_
    complexed with coa, edo; mutant

Details for d3r34a_

PDB Entry: 3r34 (more details), 1.8 Å

PDB Description: crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73d complexed with coa
PDB Compounds: (A:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d3r34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r34a_ d.38.1.5 (A:) automated matches {Arthrobacter sp. [TaxId: 1667]}
tggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggayca
ladmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslr
ddagrlcavssmsiavrprrd

SCOPe Domain Coordinates for d3r34a_:

Click to download the PDB-style file with coordinates for d3r34a_.
(The format of our PDB-style files is described here.)

Timeline for d3r34a_: