Lineage for d3r34b_ (3r34 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2943966Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries)
  8. 2943986Domain d3r34b_: 3r34 B: [195716]
    automated match to d1q4ta_
    complexed with coa, edo; mutant

Details for d3r34b_

PDB Entry: 3r34 (more details), 1.8 Å

PDB Description: crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73d complexed with coa
PDB Compounds: (B:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d3r34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r34b_ d.38.1.5 (B:) automated matches {Arthrobacter sp. [TaxId: 1667]}
ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
admlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
dagrlcavssmsiavrprrd

SCOPe Domain Coordinates for d3r34b_:

Click to download the PDB-style file with coordinates for d3r34b_.
(The format of our PDB-style files is described here.)

Timeline for d3r34b_: