![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein automated matches [190102] (7 species) not a true protein |
![]() | Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries) |
![]() | Domain d3r34b_: 3r34 B: [195716] automated match to d1q4ta_ complexed with coa, edo; mutant |
PDB Entry: 3r34 (more details), 1.8 Å
SCOPe Domain Sequences for d3r34b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r34b_ d.38.1.5 (B:) automated matches {Arthrobacter sp. [TaxId: 1667]} ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal admlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd dagrlcavssmsiavrprrd
Timeline for d3r34b_: