| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
| Protein automated matches [190102] (7 species) not a true protein |
| Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries) |
| Domain d3r32b_: 3r32 B: [195712] automated match to d1q4ta_ complexed with 4co; mutant |
PDB Entry: 3r32 (more details), 1.8 Å
SCOPe Domain Sequences for d3r32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r32b_ d.38.1.5 (B:) automated matches {Arthrobacter sp. [TaxId: 1667]}
ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
aamlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
dagrlcavssmsiavrprrd
Timeline for d3r32b_: