Lineage for d3r3fa_ (3r3f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410230Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1410323Protein automated matches [190102] (5 species)
    not a true protein
  7. 1410324Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries)
  8. 1410325Domain d3r3fa_: 3r3f A: [195711]
    automated match to d1q4ta_
    complexed with 4co; mutant

Details for d3r3fa_

PDB Entry: 3r3f (more details), 1.75 Å

PDB Description: crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant t77a complexed with 4-hydroxyphenacyl coa
PDB Compounds: (A:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d3r3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3fa_ d.38.1.5 (A:) automated matches {Arthrobacter sp. [TaxId: 1667]}
ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
aemlaaeatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
dagrlcavssmsiavrprrd

SCOPe Domain Coordinates for d3r3fa_:

Click to download the PDB-style file with coordinates for d3r3fa_.
(The format of our PDB-style files is described here.)

Timeline for d3r3fa_: